Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5391205..5391800 | Replicon | chromosome |
| Accession | NZ_LR130536 | ||
| Organism | Pseudomonas aeruginosa isolate paerg010 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | EJ099_RS25565 | Protein ID | WP_003117425.1 |
| Coordinates | 5391522..5391800 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EJ099_RS25560 | Protein ID | WP_003113527.1 |
| Coordinates | 5391205..5391510 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJ099_RS25525 | 5386289..5386576 | - | 288 | WP_088130743.1 | DUF5447 family protein | - |
| EJ099_RS25530 | 5386752..5387024 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| EJ099_RS25540 | 5387471..5387806 | + | 336 | WP_079262960.1 | hypothetical protein | - |
| EJ099_RS25545 | 5387818..5388489 | - | 672 | WP_125075348.1 | hypothetical protein | - |
| EJ099_RS25550 | 5388491..5389618 | - | 1128 | WP_125075349.1 | hypothetical protein | - |
| EJ099_RS25555 | 5389611..5390588 | - | 978 | WP_125080763.1 | hypothetical protein | - |
| EJ099_RS25560 | 5391205..5391510 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
| EJ099_RS25565 | 5391522..5391800 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EJ099_RS25575 | 5392129..5394357 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| EJ099_RS25580 | 5394427..5395074 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| EJ099_RS25585 | 5395136..5396374 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T286266 WP_003117425.1 NZ_LR130536:c5391800-5391522 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|