Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2470137..2470912 | Replicon | chromosome |
Accession | NZ_LR130534 | ||
Organism | Pseudomonas aeruginosa isolate paerg005 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V6ADY6 |
Locus tag | EJN62_RS11855 | Protein ID | WP_009518525.1 |
Coordinates | 2470454..2470912 (+) | Length | 153 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A1L1PS41 |
Locus tag | EJN62_RS11850 | Protein ID | WP_009518526.1 |
Coordinates | 2470137..2470454 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN62_RS11840 | 2465271..2467922 | + | 2652 | WP_125075549.1 | excinuclease ABC subunit UvrA | - |
EJN62_RS11845 | 2468000..2469838 | - | 1839 | WP_125075550.1 | TraI domain-containing protein | - |
EJN62_RS11850 | 2470137..2470454 | + | 318 | WP_009518526.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
EJN62_RS11855 | 2470454..2470912 | + | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
EJN62_RS11860 | 2470939..2471316 | + | 378 | WP_009518524.1 | DUF3742 family protein | - |
EJN62_RS11865 | 2471332..2472849 | - | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
EJN62_RS11870 | 2472864..2473223 | - | 360 | WP_009518522.1 | hypothetical protein | - |
EJN62_RS11875 | 2473220..2474614 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
EJN62_RS11880 | 2474624..2475571 | - | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2442353..2528671 | 86318 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T286251 WP_009518525.1 NZ_LR130534:2470454-2470912 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ADY6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1L1PS41 |