Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5786048..5786823 | Replicon | chromosome |
| Accession | NZ_LR130533 | ||
| Organism | Pseudomonas aeruginosa isolate paerg009 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | EJN60_RS27855 | Protein ID | WP_009518525.1 |
| Coordinates | 5786365..5786823 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A1L1PS41 |
| Locus tag | EJN60_RS27850 | Protein ID | WP_009518526.1 |
| Coordinates | 5786048..5786365 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN60_RS27840 | 5781182..5783833 | + | 2652 | WP_125075549.1 | excinuclease ABC subunit UvrA | - |
| EJN60_RS27845 | 5783911..5785749 | - | 1839 | WP_125075550.1 | TraI domain-containing protein | - |
| EJN60_RS27850 | 5786048..5786365 | + | 318 | WP_009518526.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| EJN60_RS27855 | 5786365..5786823 | + | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| EJN60_RS27860 | 5786850..5787227 | + | 378 | WP_009518524.1 | DUF3742 family protein | - |
| EJN60_RS27865 | 5787243..5788760 | - | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| EJN60_RS27870 | 5788775..5789134 | - | 360 | WP_009518522.1 | hypothetical protein | - |
| EJN60_RS27875 | 5789131..5790525 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
| EJN60_RS27880 | 5790535..5791482 | - | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5758264..5844582 | 86318 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T286246 WP_009518525.1 NZ_LR130533:5786365-5786823 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ADY6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L1PS41 |