Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2248366..2248961 | Replicon | chromosome |
| Accession | NZ_LR130533 | ||
| Organism | Pseudomonas aeruginosa isolate paerg009 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | EJN60_RS11050 | Protein ID | WP_003113526.1 |
| Coordinates | 2248683..2248961 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | EJN60_RS11045 | Protein ID | WP_003111575.1 |
| Coordinates | 2248366..2248671 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EJN60_RS11010 | 2243506..2244354 | + | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| EJN60_RS11020 | 2244521..2245462 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| EJN60_RS11025 | 2245579..2246193 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| EJN60_RS11030 | 2246235..2246819 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| EJN60_RS11035 | 2246860..2247960 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| EJN60_RS11045 | 2248366..2248671 | - | 306 | WP_003111575.1 | HigA family addiction module antidote protein | Antitoxin |
| EJN60_RS11050 | 2248683..2248961 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EJN60_RS11060 | 2249290..2251518 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| EJN60_RS11065 | 2251588..2252235 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| EJN60_RS11070 | 2252297..2253535 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T286242 WP_003113526.1 NZ_LR130533:c2248961-2248683 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |