Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4205987..4206786 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | EJK95_RS20570 | Protein ID | WP_000347267.1 |
Coordinates | 4206322..4206786 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EJK95_RS20565 | Protein ID | WP_001307405.1 |
Coordinates | 4205987..4206322 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS20550 | 4201774..4202544 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
EJK95_RS20555 | 4202560..4203858 | - | 1299 | WP_000557469.1 | galactarate/glucarate/glycerate transporter GarP | - |
EJK95_RS20560 | 4204267..4205838 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
EJK95_RS20565 | 4205987..4206322 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EJK95_RS20570 | 4206322..4206786 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EJK95_RS20575 | 4206841..4207650 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EJK95_RS20580 | 4207899..4209179 | + | 1281 | WP_106474742.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EJK95_RS20585 | 4209202..4209675 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EJK95_RS20590 | 4209686..4210465 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EJK95_RS20595 | 4210455..4211333 | + | 879 | WP_001355782.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EJK95_RS20600 | 4211351..4211785 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4195571..4206786 | 11215 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T286236 WP_000347267.1 NZ_LR130532:4206322-4206786 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |