Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 106543..107145 | Replicon | chromosome |
Accession | NZ_LR130532 | ||
Organism | Escherichia coli isolate ecoli019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EJK95_RS00520 | Protein ID | WP_000897305.1 |
Coordinates | 106543..106854 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EJK95_RS00525 | Protein ID | WP_000356397.1 |
Coordinates | 106855..107145 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJK95_RS00490 | 101573..102358 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
EJK95_RS00495 | 102457..103056 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
EJK95_RS00500 | 103050..103922 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
EJK95_RS00505 | 103919..104356 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EJK95_RS00510 | 104401..105342 | + | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
EJK95_RS00515 | 105406..106314 | - | 909 | WP_106474777.1 | alpha/beta hydrolase | - |
EJK95_RS00520 | 106543..106854 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EJK95_RS00525 | 106855..107145 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EJK95_RS00530 | 107750..107968 | + | 219 | WP_001295676.1 | ribbon-helix-helix domain-containing protein | - |
EJK95_RS00535 | 108187..108429 | + | 243 | WP_001086388.1 | hypothetical protein | - |
EJK95_RS00540 | 108759..109688 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
EJK95_RS00545 | 109685..110320 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EJK95_RS00550 | 110317..111219 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T286213 WP_000897305.1 NZ_LR130532:106543-106854 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|