Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1566430..1567025 | Replicon | chromosome |
Accession | NZ_LR130528 | ||
Organism | Pseudomonas aeruginosa isolate paerg000 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | EJN10_RS07470 | Protein ID | WP_003117425.1 |
Coordinates | 1566430..1566708 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EJN10_RS07475 | Protein ID | WP_003113527.1 |
Coordinates | 1566720..1567025 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN10_RS07450 | 1561856..1563094 | + | 1239 | WP_003113524.1 | dipeptidase | - |
EJN10_RS07455 | 1563156..1563803 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
EJN10_RS07460 | 1563873..1566101 | - | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
EJN10_RS07470 | 1566430..1566708 | + | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EJN10_RS07475 | 1566720..1567025 | + | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
EJN10_RS07485 | 1567431..1568531 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
EJN10_RS07490 | 1568572..1569156 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
EJN10_RS07495 | 1569198..1569812 | - | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
EJN10_RS07500 | 1569929..1570870 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
EJN10_RS07510 | 1571037..1571885 | - | 849 | WP_023114865.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T286198 WP_003117425.1 NZ_LR130528:1566430-1566708 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|