Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 2071810..2072405 | Replicon | chromosome |
Accession | NZ_LR130527 | ||
Organism | Pseudomonas aeruginosa isolate paerg002 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | EJN50_RS10000 | Protein ID | WP_003117425.1 |
Coordinates | 2072127..2072405 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EJN50_RS09995 | Protein ID | WP_003113527.1 |
Coordinates | 2071810..2072115 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EJN50_RS09960 | 2066894..2067181 | - | 288 | WP_088130743.1 | DUF5447 family protein | - |
EJN50_RS09965 | 2067357..2067629 | - | 273 | WP_004352675.1 | hypothetical protein | - |
EJN50_RS09975 | 2068076..2068411 | + | 336 | WP_079262960.1 | hypothetical protein | - |
EJN50_RS09980 | 2068423..2069094 | - | 672 | WP_125075348.1 | hypothetical protein | - |
EJN50_RS09985 | 2069096..2070223 | - | 1128 | WP_125075349.1 | hypothetical protein | - |
EJN50_RS09990 | 2070216..2071193 | - | 978 | WP_125080763.1 | hypothetical protein | - |
EJN50_RS09995 | 2071810..2072115 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
EJN50_RS10000 | 2072127..2072405 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EJN50_RS10010 | 2072734..2074962 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
EJN50_RS10015 | 2075032..2075679 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
EJN50_RS10020 | 2075741..2076979 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T286194 WP_003117425.1 NZ_LR130527:c2072405-2072127 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|