Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2108197..2108496 | Replicon | chromosome |
| Accession | NZ_LR130518 | ||
| Organism | Staphylococcus aureus strain BPH2986 isolate BPH2986 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | EW031_RS11100 | Protein ID | WP_011447039.1 |
| Coordinates | 2108320..2108496 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2108197..2108252 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW031_RS11055 | 2103528..2103788 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| EW031_RS11060 | 2103841..2104191 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| EW031_RS11065 | 2104876..2105325 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| EW031_RS11070 | 2105420..2105755 | - | 336 | Protein_2042 | SH3 domain-containing protein | - |
| EW031_RS11080 | 2106405..2106896 | - | 492 | WP_000919350.1 | staphylokinase | - |
| EW031_RS11085 | 2107087..2107842 | - | 756 | WP_129790285.1 | CHAP domain-containing protein | - |
| EW031_RS11090 | 2107854..2108108 | - | 255 | WP_000611512.1 | phage holin | - |
| EW031_RS11095 | 2108160..2108267 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2108189..2108328 | + | 140 | NuclAT_0 | - | - |
| - | 2108189..2108328 | + | 140 | NuclAT_0 | - | - |
| - | 2108189..2108328 | + | 140 | NuclAT_0 | - | - |
| - | 2108189..2108328 | + | 140 | NuclAT_0 | - | - |
| - | 2108197..2108252 | + | 56 | - | - | Antitoxin |
| EW031_RS11100 | 2108320..2108496 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| EW031_RS11105 | 2108646..2108942 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| EW031_RS11110 | 2109000..2109287 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| EW031_RS11115 | 2109334..2109486 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| EW031_RS11120 | 2109476..2113261 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2103841..2159790 | 55949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286182 WP_011447039.1 NZ_LR130518:c2108496-2108320 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286182 NZ_LR130518:2108197-2108252 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|