Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2712996..2713180 | Replicon | chromosome |
Accession | NZ_LR130515 | ||
Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | EW033_RS14440 | Protein ID | WP_000482650.1 |
Coordinates | 2713073..2713180 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2712996..2713056 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW033_RS14415 | 2708526..2708693 | - | 168 | WP_001790576.1 | hypothetical protein | - |
EW033_RS14425 | 2708924..2710657 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
EW033_RS14430 | 2710682..2712445 | - | 1764 | WP_031873766.1 | ABC transporter ATP-binding protein/permease | - |
- | 2712996..2713056 | + | 61 | - | - | Antitoxin |
EW033_RS14440 | 2713073..2713180 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EW033_RS14445 | 2713313..2713699 | - | 387 | WP_000779358.1 | flippase GtxA | - |
EW033_RS14450 | 2713967..2715109 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
EW033_RS14455 | 2715169..2715828 | + | 660 | WP_000831298.1 | membrane protein | - |
EW033_RS14460 | 2716010..2717221 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
EW033_RS14465 | 2717344..2717817 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T286177 WP_000482650.1 NZ_LR130515:c2713180-2713073 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286177 NZ_LR130515:2712996-2713056 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|