Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2422571..2422850 | Replicon | chromosome |
Accession | NZ_LR130515 | ||
Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | EW033_RS12850 | Protein ID | WP_001802298.1 |
Coordinates | 2422746..2422850 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2422571..2422750 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW033_RS12830 | 2418770..2419435 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
EW033_RS12835 | 2419587..2419907 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EW033_RS12840 | 2419909..2420889 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
EW033_RS12845 | 2421155..2422246 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2422571..2422750 | + | 180 | - | - | Antitoxin |
EW033_RS12850 | 2422746..2422850 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
EW033_RS16315 | 2423011..2423494 | - | 484 | Protein_2384 | recombinase family protein | - |
EW033_RS12860 | 2423537..2424673 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
EW033_RS12865 | 2424962..2425054 | + | 93 | WP_001790138.1 | hypothetical protein | - |
EW033_RS12870 | 2425759..2426616 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
EW033_RS12875 | 2426684..2427466 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286172 WP_001802298.1 NZ_LR130515:c2422850-2422746 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT286172 NZ_LR130515:2422571-2422750 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAGTAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAGTAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|