Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2118363..2118662 | Replicon | chromosome |
| Accession | NZ_LR130515 | ||
| Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | EW033_RS11065 | Protein ID | WP_072482930.1 |
| Coordinates | 2118486..2118662 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2118363..2118418 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW033_RS11010 | 2113921..2114100 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| EW033_RS11020 | 2114411..2114671 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| EW033_RS11025 | 2114724..2115074 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| EW033_RS11030 | 2115584..2115919 | - | 336 | Protein_2032 | SH3 domain-containing protein | - |
| EW033_RS11045 | 2116571..2117062 | - | 492 | WP_000920041.1 | staphylokinase | - |
| EW033_RS11050 | 2117253..2118008 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| EW033_RS11055 | 2118020..2118274 | - | 255 | WP_000611512.1 | phage holin | - |
| EW033_RS11060 | 2118326..2118433 | + | 108 | Protein_2036 | hypothetical protein | - |
| - | 2118355..2118494 | + | 140 | NuclAT_0 | - | - |
| - | 2118355..2118494 | + | 140 | NuclAT_0 | - | - |
| - | 2118355..2118494 | + | 140 | NuclAT_0 | - | - |
| - | 2118355..2118494 | + | 140 | NuclAT_0 | - | - |
| - | 2118363..2118418 | + | 56 | - | - | Antitoxin |
| EW033_RS11065 | 2118486..2118662 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| EW033_RS11070 | 2118771..2119544 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| EW033_RS11075 | 2119917..2120291 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| EW033_RS11080 | 2120347..2120634 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| EW033_RS11085 | 2120680..2120832 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2114724..2172248 | 57524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T286166 WP_072482930.1 NZ_LR130515:c2118662-2118486 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286166 NZ_LR130515:2118363-2118418 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|