Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1957923..1958105 | Replicon | chromosome |
| Accession | NZ_LR130515 | ||
| Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EW033_RS09980 | Protein ID | WP_001801861.1 |
| Coordinates | 1957923..1958018 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1958046..1958105 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW033_RS09930 | 1953583..1954209 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| EW033_RS09935 | 1954250..1954594 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| EW033_RS09940 | 1954692..1955243 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| EW033_RS09945 | 1955461..1956102 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW033_RS09950 | 1956216..1956401 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| EW033_RS09955 | 1956403..1956579 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| EW033_RS09960 | 1956590..1956973 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| EW033_RS09970 | 1957577..1957720 | - | 144 | WP_001549059.1 | transposase | - |
| EW033_RS09980 | 1957923..1958018 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1958046..1958105 | - | 60 | - | - | Antitoxin |
| EW033_RS09985 | 1958141..1958242 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| EW033_RS09990 | 1958220..1958396 | - | 177 | Protein_1879 | transposase | - |
| EW033_RS09995 | 1958590..1958967 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| EW033_RS10000 | 1959488..1960756 | - | 1269 | Protein_1881 | ATP-binding protein | - |
| EW033_RS10010 | 1960808..1961979 | - | 1172 | Protein_1882 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1951023..1979352 | 28329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286164 WP_001801861.1 NZ_LR130515:1957923-1958018 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT286164 NZ_LR130515:c1958105-1958046 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|