Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2218658..2218875 | Replicon | chromosome |
Accession | NZ_LR130513 | ||
Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | EW029_RS11390 | Protein ID | WP_075583739.1 |
Coordinates | 2218771..2218875 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2218658..2218713 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW029_RS11370 | 2214780..2215445 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
EW029_RS11375 | 2215597..2215917 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
EW029_RS11380 | 2215919..2216899 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
EW029_RS11385 | 2217165..2218256 | + | 1092 | WP_000495678.1 | hypothetical protein | - |
- | 2218658..2218713 | + | 56 | - | - | Antitoxin |
EW029_RS11390 | 2218771..2218875 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
EW029_RS11395 | 2218973..2219134 | - | 162 | Protein_2126 | helix-turn-helix domain-containing protein | - |
EW029_RS11405 | 2219552..2219710 | + | 159 | WP_024928151.1 | hypothetical protein | - |
EW029_RS11415 | 2220370..2221227 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
EW029_RS11420 | 2221295..2222077 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T286157 WP_075583739.1 NZ_LR130513:c2218875-2218771 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT286157 NZ_LR130513:2218658-2218713 [Staphylococcus aureus]
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCAGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|