Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF2/- |
Location | 2038227..2038526 | Replicon | chromosome |
Accession | NZ_LR130513 | ||
Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EW029_RS10340 | Protein ID | WP_011447039.1 |
Coordinates | 2038350..2038526 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2038227..2038282 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW029_RS10295 | 2033558..2033818 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EW029_RS10300 | 2033871..2034221 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
EW029_RS10305 | 2034906..2035355 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
EW029_RS10310 | 2035450..2035785 | - | 336 | Protein_1920 | SH3 domain-containing protein | - |
EW029_RS10320 | 2036435..2036926 | - | 492 | WP_000919349.1 | staphylokinase | - |
EW029_RS10325 | 2037117..2037872 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EW029_RS10330 | 2037884..2038138 | - | 255 | WP_000611512.1 | phage holin | - |
EW029_RS10335 | 2038190..2038297 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2038219..2038358 | + | 140 | NuclAT_1 | - | - |
- | 2038219..2038358 | + | 140 | NuclAT_1 | - | - |
- | 2038219..2038358 | + | 140 | NuclAT_1 | - | - |
- | 2038219..2038358 | + | 140 | NuclAT_1 | - | - |
- | 2038227..2038282 | + | 56 | - | - | Antitoxin |
EW029_RS10340 | 2038350..2038526 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EW029_RS10345 | 2038676..2038972 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
EW029_RS10350 | 2039030..2039317 | - | 288 | WP_001040261.1 | hypothetical protein | - |
EW029_RS10355 | 2039364..2039516 | - | 153 | WP_001153681.1 | hypothetical protein | - |
EW029_RS10360 | 2039506..2043291 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL / hld | 2033871..2113111 | 79240 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286154 WP_011447039.1 NZ_LR130513:c2038526-2038350 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286154 NZ_LR130513:2038227-2038282 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|