Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2038219..2038526 | Replicon | chromosome |
| Accession | NZ_LR130513 | ||
| Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | EW029_RS10340 | Protein ID | WP_011447039.1 |
| Coordinates | 2038350..2038526 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2038219..2038358 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW029_RS10295 | 2033558..2033818 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| EW029_RS10300 | 2033871..2034221 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| EW029_RS10305 | 2034906..2035355 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| EW029_RS10310 | 2035450..2035785 | - | 336 | Protein_1920 | SH3 domain-containing protein | - |
| EW029_RS10320 | 2036435..2036926 | - | 492 | WP_000919349.1 | staphylokinase | - |
| EW029_RS10325 | 2037117..2037872 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| EW029_RS10330 | 2037884..2038138 | - | 255 | WP_000611512.1 | phage holin | - |
| EW029_RS10335 | 2038190..2038297 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2038219..2038358 | + | 140 | NuclAT_1 | - | Antitoxin |
| - | 2038219..2038358 | + | 140 | NuclAT_1 | - | Antitoxin |
| - | 2038219..2038358 | + | 140 | NuclAT_1 | - | Antitoxin |
| - | 2038219..2038358 | + | 140 | NuclAT_1 | - | Antitoxin |
| EW029_RS10340 | 2038350..2038526 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| EW029_RS10345 | 2038676..2038972 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| EW029_RS10350 | 2039030..2039317 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| EW029_RS10355 | 2039364..2039516 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| EW029_RS10360 | 2039506..2043291 | - | 3786 | WP_000582168.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL / hld | 2033871..2113111 | 79240 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286153 WP_011447039.1 NZ_LR130513:c2038526-2038350 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT286153 NZ_LR130513:2038219-2038358 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|