Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1885247..1885427 Replicon chromosome
Accession NZ_LR130513
Organism Staphylococcus aureus strain BPH2900 isolate BPH2900

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag EW029_RS09330 Protein ID WP_001801861.1
Coordinates 1885247..1885342 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1885370..1885427 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW029_RS09285 1881028..1881654 + 627 WP_000669029.1 hypothetical protein -
EW029_RS09290 1881695..1882036 + 342 WP_000627536.1 DUF3969 family protein -
EW029_RS09295 1882137..1882709 + 573 WP_000414208.1 hypothetical protein -
EW029_RS09300 1882906..1883475 - 570 WP_000864144.1 ImmA/IrrE family metallo-endopeptidase -
EW029_RS09305 1883661..1883846 - 186 WP_000809864.1 hypothetical protein -
EW029_RS09310 1883848..1884024 - 177 WP_000375476.1 hypothetical protein -
EW029_RS09315 1884035..1884418 - 384 WP_000070809.1 hypothetical protein -
EW029_RS09320 1884600..1884824 - 225 WP_001805677.1 IS3 family transposase -
EW029_RS09325 1884998..1885102 - 105 WP_001670380.1 transposase -
EW029_RS09330 1885247..1885342 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1885370..1885427 - 58 - - Antitoxin
EW029_RS09335 1885465..1885566 + 102 WP_001791232.1 hypothetical protein -
EW029_RS09340 1885544..1885716 - 173 Protein_1774 transposase -
EW029_RS09345 1885910..1886287 - 378 WP_001036002.1 DUF1433 domain-containing protein -
EW029_RS09350 1886493..1886933 - 441 WP_000759947.1 DUF1433 domain-containing protein -
EW029_RS09355 1886978..1888591 + 1614 WP_000926708.1 lipase -
EW029_RS09360 1888606..1888905 + 300 WP_000095392.1 WXG100 family type VII secretion target -
EW029_RS09365 1889222..1890403 - 1182 WP_000162901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selk 1858099..1901657 43558


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286151 WP_001801861.1 NZ_LR130513:1885247-1885342 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT286151 NZ_LR130513:c1885427-1885370 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References