Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 1516197..1516504 | Replicon | chromosome |
Accession | NZ_LR130513 | ||
Organism | Staphylococcus aureus strain BPH2900 isolate BPH2900 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EW029_RS07370 | Protein ID | WP_011447039.1 |
Coordinates | 1516328..1516504 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 1516197..1516336 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW029_RS14565 | 1511439..1511654 | - | 216 | WP_170267452.1 | hypothetical protein | - |
EW029_RS07345 | 1511833..1512843 | - | 1011 | WP_000777019.1 | restriction endonuclease subunit S | - |
EW029_RS07350 | 1512830..1514734 | - | 1905 | WP_001003363.1 | N-6 DNA methylase | - |
EW029_RS07355 | 1515095..1515850 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EW029_RS07360 | 1515862..1516116 | - | 255 | WP_000611512.1 | phage holin | - |
EW029_RS07365 | 1516168..1516275 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1516197..1516336 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1516197..1516336 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1516197..1516336 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1516197..1516336 | + | 140 | NuclAT_0 | - | Antitoxin |
EW029_RS07370 | 1516328..1516504 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EW029_RS07375 | 1516657..1516956 | - | 300 | WP_000466784.1 | DUF2951 domain-containing protein | - |
EW029_RS07380 | 1517002..1517166 | - | 165 | WP_000916020.1 | XkdX family protein | - |
EW029_RS07385 | 1517159..1517548 | - | 390 | WP_001166596.1 | DUF2977 domain-containing protein | - |
EW029_RS07390 | 1517548..1519014 | - | 1467 | WP_000067127.1 | BppU family phage baseplate upper protein | - |
EW029_RS07395 | 1519014..1520924 | - | 1911 | WP_000429558.1 | minor structural protein | - |
EW029_RS07400 | 1520940..1521230 | - | 291 | WP_000179858.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1511439..1579806 | 68367 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286146 WP_011447039.1 NZ_LR130513:c1516504-1516328 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT286146 NZ_LR130513:1516197-1516336 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|