Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2418562..2418746 | Replicon | chromosome |
Accession | NZ_LR130511 | ||
Organism | Staphylococcus aureus strain BPH2819 isolate BPH2819 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | EW030_RS12550 | Protein ID | WP_000482652.1 |
Coordinates | 2418639..2418746 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2418562..2418622 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW030_RS12525 | 2414017..2414184 | - | 168 | Protein_2305 | hypothetical protein | - |
EW030_RS12535 | 2414415..2416148 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
EW030_RS12540 | 2416173..2417936 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2418562..2418622 | + | 61 | - | - | Antitoxin |
EW030_RS12550 | 2418639..2418746 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EW030_RS12555 | 2418880..2419266 | - | 387 | WP_000779360.1 | flippase GtxA | - |
EW030_RS12560 | 2419534..2420676 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
EW030_RS12565 | 2420736..2421395 | + | 660 | WP_000831298.1 | membrane protein | - |
EW030_RS12570 | 2421577..2422788 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
EW030_RS12575 | 2422911..2423384 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T286143 WP_000482652.1 NZ_LR130511:c2418746-2418639 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286143 NZ_LR130511:2418562-2418622 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|