Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2127612..2127828 | Replicon | chromosome |
| Accession | NZ_LR130511 | ||
| Organism | Staphylococcus aureus strain BPH2819 isolate BPH2819 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | EW030_RS10950 | Protein ID | WP_001802298.1 |
| Coordinates | 2127724..2127828 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2127612..2127667 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW030_RS10930 | 2123818..2124483 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| EW030_RS10935 | 2124635..2124955 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| EW030_RS10940 | 2124957..2125934 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| EW030_RS10945 | 2126200..2127291 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
| - | 2127612..2127667 | + | 56 | - | - | Antitoxin |
| EW030_RS10950 | 2127724..2127828 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| EW030_RS10960 | 2128508..2128666 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| EW030_RS10970 | 2129324..2130181 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
| EW030_RS10975 | 2130249..2131031 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286140 WP_001802298.1 NZ_LR130511:c2127828-2127724 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT286140 NZ_LR130511:2127612-2127667 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|