Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1955832..1956131 | Replicon | chromosome |
Accession | NZ_LR130511 | ||
Organism | Staphylococcus aureus strain BPH2819 isolate BPH2819 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EW030_RS09960 | Protein ID | WP_011447039.1 |
Coordinates | 1955955..1956131 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1955832..1955889 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW030_RS09905 | 1950861..1951111 | + | 251 | Protein_1825 | sphingomyelin phosphodiesterase | - |
EW030_RS09910 | 1951433..1951612 | + | 180 | WP_000669789.1 | hypothetical protein | - |
EW030_RS09920 | 1951923..1952183 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EW030_RS09925 | 1952236..1952586 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
EW030_RS09930 | 1953097..1953435 | - | 339 | Protein_1829 | SH3 domain-containing protein | - |
EW030_RS09940 | 1954040..1954531 | - | 492 | WP_000920041.1 | staphylokinase | - |
EW030_RS09945 | 1954722..1955477 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EW030_RS09950 | 1955489..1955743 | - | 255 | WP_000611512.1 | phage holin | - |
EW030_RS09955 | 1955795..1955902 | + | 108 | WP_031790389.1 | hypothetical protein | - |
- | 1955824..1955963 | + | 140 | NuclAT_0 | - | - |
- | 1955824..1955963 | + | 140 | NuclAT_0 | - | - |
- | 1955824..1955963 | + | 140 | NuclAT_0 | - | - |
- | 1955824..1955963 | + | 140 | NuclAT_0 | - | - |
- | 1955832..1955889 | + | 58 | - | - | Antitoxin |
EW030_RS09960 | 1955955..1956131 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EW030_RS09965 | 1956281..1956577 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
EW030_RS09970 | 1956635..1956922 | - | 288 | WP_001040254.1 | hypothetical protein | - |
EW030_RS09975 | 1956969..1957121 | - | 153 | WP_001153681.1 | hypothetical protein | - |
EW030_RS09980 | 1957111..1960896 | - | 3786 | WP_061737661.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1952236..2002192 | 49956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T286136 WP_011447039.1 NZ_LR130511:c1956131-1955955 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 58 bp
>AT286136 NZ_LR130511:1955832-1955889 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|