Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1802245..1802425 | Replicon | chromosome |
| Accession | NZ_LR130511 | ||
| Organism | Staphylococcus aureus strain BPH2819 isolate BPH2819 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EW030_RS08940 | Protein ID | WP_001801861.1 |
| Coordinates | 1802245..1802340 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1802368..1802425 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW030_RS08910 | 1797408..1798058 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| EW030_RS08915 | 1798139..1799134 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| EW030_RS08920 | 1799209..1799835 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| EW030_RS08925 | 1799876..1800217 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| EW030_RS08930 | 1800318..1800890 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| EW030_RS08935 | 1801088..1802100 | - | 1013 | Protein_1676 | IS3 family transposase | - |
| EW030_RS08940 | 1802245..1802340 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1802368..1802425 | - | 58 | - | - | Antitoxin |
| EW030_RS08945 | 1802463..1802564 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| EW030_RS08950 | 1802542..1802703 | - | 162 | Protein_1679 | transposase | - |
| EW030_RS08955 | 1802694..1803188 | - | 495 | Protein_1680 | transposase | - |
| EW030_RS08960 | 1803640..1804869 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| EW030_RS08965 | 1804862..1806418 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| EW030_RS08970 | 1806582..1806716 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1796651..1861836 | 65185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286134 WP_001801861.1 NZ_LR130511:1802245-1802340 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT286134 NZ_LR130511:c1802425-1802368 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|