Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1802245..1802425 Replicon chromosome
Accession NZ_LR130511
Organism Staphylococcus aureus strain BPH2819 isolate BPH2819

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag EW030_RS08940 Protein ID WP_001801861.1
Coordinates 1802245..1802340 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1802368..1802425 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW030_RS08910 1797408..1798058 + 651 WP_001795210.1 excalibur calcium-binding domain-containing protein -
EW030_RS08915 1798139..1799134 + 996 WP_000070642.1 DUF4352 domain-containing protein -
EW030_RS08920 1799209..1799835 + 627 WP_000669024.1 hypothetical protein -
EW030_RS08925 1799876..1800217 + 342 WP_000627540.1 DUF3969 family protein -
EW030_RS08930 1800318..1800890 + 573 WP_000414216.1 hypothetical protein -
EW030_RS08935 1801088..1802100 - 1013 Protein_1676 IS3 family transposase -
EW030_RS08940 1802245..1802340 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1802368..1802425 - 58 - - Antitoxin
EW030_RS08945 1802463..1802564 + 102 WP_001792025.1 hypothetical protein -
EW030_RS08950 1802542..1802703 - 162 Protein_1679 transposase -
EW030_RS08955 1802694..1803188 - 495 Protein_1680 transposase -
EW030_RS08960 1803640..1804869 - 1230 WP_000072627.1 restriction endonuclease subunit S -
EW030_RS08965 1804862..1806418 - 1557 WP_000028669.1 type I restriction-modification system subunit M -
EW030_RS08970 1806582..1806716 - 135 WP_001791797.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA / selk 1796651..1861836 65185


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286134 WP_001801861.1 NZ_LR130511:1802245-1802340 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT286134 NZ_LR130511:c1802425-1802368 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References