Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1825314..1825496 | Replicon | chromosome |
| Accession | NZ_LR130509 | ||
| Organism | Staphylococcus aureus strain BPH2760 isolate BPH2760 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EW032_RS09105 | Protein ID | WP_001801861.1 |
| Coordinates | 1825314..1825409 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1825437..1825496 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW032_RS09055 | 1820984..1821610 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| EW032_RS09060 | 1821651..1821992 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| EW032_RS09065 | 1822093..1822665 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| EW032_RS09070 | 1822863..1823420 | - | 558 | Protein_1700 | ImmA/IrrE family metallo-endopeptidase | - |
| EW032_RS09080 | 1823794..1823970 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| EW032_RS09085 | 1823981..1824364 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| EW032_RS09095 | 1824968..1825111 | - | 144 | WP_001549059.1 | transposase | - |
| EW032_RS09105 | 1825314..1825409 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1825437..1825496 | - | 60 | - | - | Antitoxin |
| EW032_RS09110 | 1825532..1825633 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| EW032_RS09115 | 1825611..1825787 | - | 177 | Protein_1706 | transposase | - |
| EW032_RS09120 | 1825981..1826358 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286124 WP_001801861.1 NZ_LR130509:1825314-1825409 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT286124 NZ_LR130509:c1825496-1825437 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|