Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2423994..2424257 | Replicon | chromosome |
Accession | NZ_LR027878 | ||
Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | E0E10_RS12890 | Protein ID | WP_001802298.1 |
Coordinates | 2424153..2424257 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2423994..2424158 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E10_RS12870 | 2420177..2420842 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
E0E10_RS12875 | 2420994..2421314 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
E0E10_RS12880 | 2421316..2422296 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
E0E10_RS12885 | 2422562..2423653 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2423994..2424158 | + | 165 | - | - | Antitoxin |
E0E10_RS12890 | 2424153..2424257 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
E0E10_RS16355 | 2424418..2424901 | - | 484 | Protein_2389 | recombinase family protein | - |
E0E10_RS12900 | 2424944..2426080 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
E0E10_RS12905 | 2426369..2426461 | + | 93 | WP_001790138.1 | hypothetical protein | - |
E0E10_RS12910 | 2427166..2428023 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
E0E10_RS12915 | 2428091..2428873 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286097 WP_001802298.1 NZ_LR027878:c2424257-2424153 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT286097 NZ_LR027878:2423994-2424158 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAGTAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAGTAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|