Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2119942..2120241 | Replicon | chromosome |
| Accession | NZ_LR027878 | ||
| Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | E0E10_RS11110 | Protein ID | WP_072482930.1 |
| Coordinates | 2120065..2120241 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2119942..2119997 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E10_RS11055 | 2115500..2115679 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| E0E10_RS11065 | 2115990..2116250 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| E0E10_RS11070 | 2116303..2116653 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| E0E10_RS11075 | 2117163..2117498 | - | 336 | Protein_2038 | SH3 domain-containing protein | - |
| E0E10_RS11090 | 2118150..2118641 | - | 492 | WP_000920041.1 | staphylokinase | - |
| E0E10_RS11095 | 2118832..2119587 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| E0E10_RS11100 | 2119599..2119853 | - | 255 | WP_000611512.1 | phage holin | - |
| E0E10_RS11105 | 2119905..2120012 | + | 108 | Protein_2042 | hypothetical protein | - |
| - | 2119934..2120073 | + | 140 | NuclAT_0 | - | - |
| - | 2119934..2120073 | + | 140 | NuclAT_0 | - | - |
| - | 2119934..2120073 | + | 140 | NuclAT_0 | - | - |
| - | 2119934..2120073 | + | 140 | NuclAT_0 | - | - |
| - | 2119942..2119997 | + | 56 | - | - | Antitoxin |
| E0E10_RS11110 | 2120065..2120241 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| E0E10_RS11115 | 2120350..2121123 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| E0E10_RS11120 | 2121496..2121870 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| E0E10_RS11125 | 2121926..2122213 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| E0E10_RS11130 | 2122259..2122411 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2116303..2173511 | 57208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T286089 WP_072482930.1 NZ_LR027878:c2120241-2120065 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286089 NZ_LR027878:2119942-2119997 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|