Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2284533..2284812 | Replicon | chromosome |
Accession | NZ_LR027877 | ||
Organism | Staphylococcus aureus isolate BPH3244 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | E0E14_RS11990 | Protein ID | WP_001802298.1 |
Coordinates | 2284708..2284812 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2284533..2284712 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E14_RS11970 | 2280732..2281397 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
E0E14_RS11975 | 2281549..2281869 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
E0E14_RS11980 | 2281871..2282851 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
E0E14_RS11985 | 2283117..2284208 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2284533..2284712 | + | 180 | - | - | Antitoxin |
E0E14_RS11990 | 2284708..2284812 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
E0E14_RS15400 | 2284973..2285456 | - | 484 | Protein_2213 | recombinase family protein | - |
E0E14_RS12000 | 2285499..2286635 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
E0E14_RS12005 | 2286924..2287016 | + | 93 | WP_001790138.1 | hypothetical protein | - |
E0E14_RS12010 | 2287721..2288578 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
E0E14_RS12015 | 2288646..2289428 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286078 WP_001802298.1 NZ_LR027877:c2284812-2284708 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT286078 NZ_LR027877:2284533-2284712 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|