Detailed information of TA system TA286073

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): txpA-SprF3/-
• Location: 2107117..2107416
• Replicon: chromosome
• Accession: NZ_LR027877
• Organism: Staphylococcus aureus isolate BPH3244

Toxin (Protein)

• Gene name: txpA
• Uniprot ID: -
• Locus tag: E0E14_RS10945
• Protein ID: WP_072353918.1
• Coordinates: 2107240..2107416 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SprF3
Locus tag	-
Coordinates	2107117..2107172 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E0E14_RS10900	2103079..2103329	+	251	Protein_2011	sphingomyelin phosphodiesterase	-
E0E14_RS10905	2103651..2103830	+	180	WP_000669791.1	hypothetical protein	-
E0E14_RS10915	2104141..2104401	+	261	WP_001791826.1	hypothetical protein	-
E0E14_RS10920	2104454..2104804	-	351	WP_000702263.1	complement inhibitor SCIN-A	-
E0E14_RS10925	2105325..2105816	-	492	WP_000920038.1	staphylokinase	-
E0E14_RS10930	2106007..2106762	-	756	WP_000861038.1	CHAP domain-containing protein	-
E0E14_RS10935	2106774..2107028	-	255	WP_000611512.1	phage holin	-
E0E14_RS10940	2107080..2107187	+	108	WP_001791821.1	hypothetical protein	-
-	2107109..2107248	+	140	NuclAT_0	-	-
-	2107109..2107248	+	140	NuclAT_0	-	-
-	2107109..2107248	+	140	NuclAT_0	-	-
-	2107109..2107248	+	140	NuclAT_0	-	-
-	2107117..2107172	+	56	-	-	Antitoxin
E0E14_RS10945	2107240..2107416	-	177	WP_072353918.1	putative holin-like toxin	Toxin
E0E14_RS10950	2107559..2107933	-	375	WP_000340977.1	hypothetical protein	-
E0E14_RS10955	2107989..2108276	-	288	WP_001262620.1	hypothetical protein	-
E0E14_RS10960	2108322..2108474	-	153	WP_001000058.1	hypothetical protein	-
E0E14_RS10965	2108467..2112249	-	3783	WP_000582132.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	scn / sak / hlb / groEL	2104454..2161271	56817
	-	inside	Prophage	-	scn / sak / hlb / groEL	2104454..2164296	59842

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (30-58)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6810.43 Da
• Isoelectric Point: 9.9479

>T286073 WP_072353918.1 NZ_LR027877:c2107416-2107240 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 56 bp

>AT286073 NZ_LR027877:2107117-2107172 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Structures

Antitoxin