Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1905089..1905271 | Replicon | chromosome |
Accession | NZ_LR027877 | ||
Organism | Staphylococcus aureus isolate BPH3244 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E0E14_RS09575 | Protein ID | WP_001801861.1 |
Coordinates | 1905089..1905184 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1905212..1905271 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E14_RS09525 | 1900749..1901375 | + | 627 | WP_000669046.1 | hypothetical protein | - |
E0E14_RS09530 | 1901416..1901760 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
E0E14_RS09535 | 1901858..1902409 | + | 552 | WP_000414205.1 | hypothetical protein | - |
E0E14_RS09540 | 1902627..1903268 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
E0E14_RS09545 | 1903382..1903567 | - | 186 | WP_000809857.1 | hypothetical protein | - |
E0E14_RS09550 | 1903569..1903745 | - | 177 | WP_000375476.1 | hypothetical protein | - |
E0E14_RS09555 | 1903756..1904139 | - | 384 | WP_000070811.1 | hypothetical protein | - |
E0E14_RS09565 | 1904743..1904886 | - | 144 | WP_001549059.1 | transposase | - |
E0E14_RS09575 | 1905089..1905184 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1905212..1905271 | - | 60 | - | - | Antitoxin |
E0E14_RS09580 | 1905307..1905408 | + | 102 | WP_001791893.1 | hypothetical protein | - |
E0E14_RS09585 | 1905386..1905562 | - | 177 | Protein_1801 | transposase | - |
E0E14_RS09590 | 1905756..1906133 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T286071 WP_001801861.1 NZ_LR027877:1905089-1905184 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT286071 NZ_LR027877:c1905271-1905212 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|