Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2300706..2300923 | Replicon | chromosome |
Accession | NZ_LR027876 | ||
Organism | Staphylococcus aureus strain JKD6009 isolate JKD6009 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | E0E12_RS12195 | Protein ID | WP_001802298.1 |
Coordinates | 2300819..2300923 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2300706..2300761 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E12_RS12175 | 2296843..2297508 | - | 666 | WP_001024106.1 | SDR family oxidoreductase | - |
E0E12_RS12180 | 2297660..2297980 | + | 321 | WP_000003760.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
E0E12_RS12185 | 2297982..2298962 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
E0E12_RS12190 | 2299228..2300319 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2300706..2300761 | + | 56 | - | - | Antitoxin |
E0E12_RS12195 | 2300819..2300923 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
E0E12_RS15480 | 2301084..2301567 | - | 484 | Protein_2250 | recombinase family protein | - |
E0E12_RS12205 | 2301610..2302746 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
E0E12_RS12210 | 2303035..2303127 | + | 93 | WP_001790138.1 | hypothetical protein | - |
E0E12_RS12215 | 2303832..2304689 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
E0E12_RS12220 | 2304757..2305539 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286064 WP_001802298.1 NZ_LR027876:c2300923-2300819 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT286064 NZ_LR027876:2300706-2300761 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|