Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2125152..2125451 | Replicon | chromosome |
| Accession | NZ_LR027876 | ||
| Organism | Staphylococcus aureus strain JKD6009 isolate JKD6009 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | E0E12_RS11185 | Protein ID | WP_072482930.1 |
| Coordinates | 2125275..2125451 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2125152..2125207 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E12_RS11150 | 2121675..2122241 | + | 567 | WP_001807342.1 | multidrug-binding transcriptional regulator QacR | - |
| E0E12_RS11155 | 2122374..2122559 | - | 186 | WP_000797248.1 | helix-turn-helix transcriptional regulator | - |
| E0E12_RS11160 | 2122564..2122902 | - | 339 | WP_001049146.1 | hypothetical protein | - |
| E0E12_RS11165 | 2123148..2123756 | - | 609 | WP_000583528.1 | recombinase family protein | - |
| E0E12_RS11170 | 2124039..2124302 | + | 264 | WP_000495112.1 | DUF4238 domain-containing protein | - |
| E0E12_RS11175 | 2124332..2125006 | + | 675 | WP_001106019.1 | IS6-like element IS257 family transposase | - |
| E0E12_RS11180 | 2125115..2125222 | + | 108 | Protein_2058 | hypothetical protein | - |
| - | 2125144..2125283 | + | 140 | NuclAT_0 | - | - |
| - | 2125144..2125283 | + | 140 | NuclAT_0 | - | - |
| - | 2125144..2125283 | + | 140 | NuclAT_0 | - | - |
| - | 2125144..2125283 | + | 140 | NuclAT_0 | - | - |
| - | 2125152..2125207 | + | 56 | - | - | Antitoxin |
| E0E12_RS11185 | 2125275..2125451 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| E0E12_RS11190 | 2125560..2126333 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| E0E12_RS11195 | 2126706..2127080 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| E0E12_RS11200 | 2127136..2127423 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| E0E12_RS11205 | 2127469..2127621 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sea / hlb / groEL | 2122374..2177384 | 55010 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T286056 WP_072482930.1 NZ_LR027876:c2125451-2125275 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286056 NZ_LR027876:2125152-2125207 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|