Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1919144..1919326 Replicon chromosome
Accession NZ_LR027876
Organism Staphylococcus aureus strain JKD6009 isolate JKD6009

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag E0E12_RS09730 Protein ID WP_001801861.1
Coordinates 1919144..1919239 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1919267..1919326 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E12_RS09680 1914804..1915430 + 627 WP_000669046.1 hypothetical protein -
E0E12_RS09685 1915471..1915815 + 345 WP_000627551.1 DUF3969 family protein -
E0E12_RS09690 1915913..1916464 + 552 WP_000414205.1 hypothetical protein -
E0E12_RS09695 1916682..1917323 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
E0E12_RS09700 1917437..1917622 - 186 WP_000809857.1 hypothetical protein -
E0E12_RS09705 1917624..1917800 - 177 WP_000375476.1 hypothetical protein -
E0E12_RS09710 1917811..1918194 - 384 WP_000070811.1 hypothetical protein -
E0E12_RS09720 1918798..1918941 - 144 WP_001549059.1 transposase -
E0E12_RS09730 1919144..1919239 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1919267..1919326 - 60 - - Antitoxin
E0E12_RS09735 1919362..1919463 + 102 WP_001791893.1 hypothetical protein -
E0E12_RS09740 1919441..1919617 - 177 Protein_1827 transposase -
E0E12_RS09745 1919811..1920188 - 378 WP_001037045.1 DUF1433 domain-containing protein -
E0E12_RS09750 1920709..1921938 - 1230 Protein_1829 ATP-binding protein -
E0E12_RS09755 1922040..1923211 + 1172 Protein_1830 IS256-like element IS256 family transposase -
E0E12_RS09760 1923264..1923440 + 177 Protein_1831 DUF1829 domain-containing protein -
E0E12_RS09765 1923901..1924109 + 209 Protein_1832 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T286054 WP_001801861.1 NZ_LR027876:1919144-1919239 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT286054 NZ_LR027876:c1919326-1919267 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References