Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2373644..2373923 | Replicon | chromosome |
| Accession | NZ_LR027874 | ||
| Organism | Staphylococcus aureus strain BPH2056 isolate BPH2056 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | E0E13_RS12490 | Protein ID | WP_001802298.1 |
| Coordinates | 2373819..2373923 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2373644..2373823 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E13_RS12470 | 2369843..2370508 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| E0E13_RS12475 | 2370660..2370980 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| E0E13_RS12480 | 2370982..2371962 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| E0E13_RS12485 | 2372228..2373319 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2373644..2373823 | + | 180 | - | - | Antitoxin |
| E0E13_RS12490 | 2373819..2373923 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| E0E13_RS15910 | 2374084..2374567 | - | 484 | Protein_2317 | recombinase family protein | - |
| E0E13_RS12500 | 2374610..2375746 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| E0E13_RS12505 | 2376035..2376127 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| E0E13_RS12510 | 2376832..2377689 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
| E0E13_RS12515 | 2377757..2378539 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T286045 WP_001802298.1 NZ_LR027874:c2373923-2373819 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT286045 NZ_LR027874:2373644-2373823 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|