Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2072387..2072686 | Replicon | chromosome |
| Accession | NZ_LR027874 | ||
| Organism | Staphylococcus aureus strain BPH2056 isolate BPH2056 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | E0E13_RS10745 | Protein ID | WP_072482930.1 |
| Coordinates | 2072510..2072686 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2072387..2072442 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E13_RS10690 | 2067945..2068124 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| E0E13_RS10700 | 2068435..2068695 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| E0E13_RS10705 | 2068748..2069098 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| E0E13_RS10710 | 2069608..2069943 | - | 336 | Protein_1973 | SH3 domain-containing protein | - |
| E0E13_RS10725 | 2070595..2071086 | - | 492 | WP_000920041.1 | staphylokinase | - |
| E0E13_RS10730 | 2071277..2072032 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| E0E13_RS10735 | 2072044..2072298 | - | 255 | WP_000611512.1 | phage holin | - |
| E0E13_RS10740 | 2072350..2072457 | + | 108 | Protein_1977 | hypothetical protein | - |
| - | 2072379..2072518 | + | 140 | NuclAT_0 | - | - |
| - | 2072379..2072518 | + | 140 | NuclAT_0 | - | - |
| - | 2072379..2072518 | + | 140 | NuclAT_0 | - | - |
| - | 2072379..2072518 | + | 140 | NuclAT_0 | - | - |
| - | 2072387..2072442 | + | 56 | - | - | Antitoxin |
| E0E13_RS10745 | 2072510..2072686 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| E0E13_RS10750 | 2072795..2073568 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| E0E13_RS10755 | 2073941..2074315 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| E0E13_RS10760 | 2074371..2074658 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| E0E13_RS10765 | 2074704..2074856 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2068748..2124619 | 55871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T286039 WP_072482930.1 NZ_LR027874:c2072686-2072510 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286039 NZ_LR027874:2072387-2072442 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|