Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2081212..2081511 | Replicon | chromosome |
| Accession | NZ_LR027870 | ||
| Organism | Staphylococcus aureus strain BPH2019 isolate BPH2019 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | E0E15_RS10780 | Protein ID | WP_072482930.1 |
| Coordinates | 2081335..2081511 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2081212..2081267 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E15_RS10725 | 2076770..2076949 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| E0E15_RS10735 | 2077260..2077520 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| E0E15_RS10740 | 2077573..2077923 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| E0E15_RS10745 | 2078433..2078768 | - | 336 | Protein_1977 | SH3 domain-containing protein | - |
| E0E15_RS10760 | 2079420..2079911 | - | 492 | WP_000920041.1 | staphylokinase | - |
| E0E15_RS10765 | 2080102..2080857 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| E0E15_RS10770 | 2080869..2081123 | - | 255 | WP_000611512.1 | phage holin | - |
| E0E15_RS10775 | 2081175..2081282 | + | 108 | Protein_1981 | hypothetical protein | - |
| - | 2081204..2081343 | + | 140 | NuclAT_0 | - | - |
| - | 2081204..2081343 | + | 140 | NuclAT_0 | - | - |
| - | 2081204..2081343 | + | 140 | NuclAT_0 | - | - |
| - | 2081204..2081343 | + | 140 | NuclAT_0 | - | - |
| - | 2081212..2081267 | + | 56 | - | - | Antitoxin |
| E0E15_RS10780 | 2081335..2081511 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| E0E15_RS10785 | 2081620..2082393 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| E0E15_RS10790 | 2082766..2083140 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| E0E15_RS10795 | 2083196..2083483 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| E0E15_RS10800 | 2083529..2083681 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2075451..2131655 | 56204 | |
| - | flank | IS/Tn | - | - | 2075451..2076623 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T286013 WP_072482930.1 NZ_LR027870:c2081511-2081335 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT286013 NZ_LR027870:2081212-2081267 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|