Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2602327..2602511 | Replicon | chromosome |
Accession | NZ_LR027869 | ||
Organism | Staphylococcus aureus isolate BPH2869 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | E0E09_RS13840 | Protein ID | WP_000482650.1 |
Coordinates | 2602404..2602511 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2602327..2602387 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E09_RS13815 | 2597857..2598024 | - | 168 | WP_001790576.1 | hypothetical protein | - |
E0E09_RS13825 | 2598255..2599988 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
E0E09_RS13830 | 2600013..2601776 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2602327..2602387 | + | 61 | - | - | Antitoxin |
E0E09_RS13840 | 2602404..2602511 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
E0E09_RS13845 | 2602644..2603030 | - | 387 | WP_000779358.1 | flippase GtxA | - |
E0E09_RS13850 | 2603298..2604440 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
E0E09_RS13855 | 2604500..2605159 | + | 660 | WP_000831298.1 | membrane protein | - |
E0E09_RS13860 | 2605341..2606552 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
E0E09_RS13865 | 2606675..2607148 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T286006 WP_000482650.1 NZ_LR027869:c2602511-2602404 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT286006 NZ_LR027869:2602327-2602387 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|