Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2133730..2134029 | Replicon | chromosome |
Accession | NZ_LR027869 | ||
Organism | Staphylococcus aureus isolate BPH2869 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | E0E09_RS11225 | Protein ID | WP_072482930.1 |
Coordinates | 2133853..2134029 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2133730..2133785 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E09_RS11170 | 2129288..2129467 | + | 180 | WP_000669789.1 | hypothetical protein | - |
E0E09_RS11180 | 2129778..2130038 | + | 261 | WP_001791826.1 | hypothetical protein | - |
E0E09_RS11185 | 2130091..2130441 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
E0E09_RS11190 | 2130951..2131286 | - | 336 | Protein_2059 | SH3 domain-containing protein | - |
E0E09_RS11205 | 2131938..2132429 | - | 492 | WP_000920041.1 | staphylokinase | - |
E0E09_RS11210 | 2132620..2133375 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
E0E09_RS11215 | 2133387..2133641 | - | 255 | WP_000611512.1 | phage holin | - |
E0E09_RS11220 | 2133693..2133800 | + | 108 | Protein_2063 | hypothetical protein | - |
- | 2133722..2133861 | + | 140 | NuclAT_0 | - | - |
- | 2133722..2133861 | + | 140 | NuclAT_0 | - | - |
- | 2133722..2133861 | + | 140 | NuclAT_0 | - | - |
- | 2133722..2133861 | + | 140 | NuclAT_0 | - | - |
- | 2133730..2133785 | + | 56 | - | - | Antitoxin |
E0E09_RS11225 | 2133853..2134029 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
E0E09_RS11230 | 2134138..2134911 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
E0E09_RS11235 | 2135284..2135658 | - | 375 | WP_000340977.1 | hypothetical protein | - |
E0E09_RS11240 | 2135714..2136001 | - | 288 | WP_001262621.1 | hypothetical protein | - |
E0E09_RS11245 | 2136047..2136199 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / sak / sea / hlb / groEL | 2116017..2185973 | 69956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T285996 WP_072482930.1 NZ_LR027869:c2134029-2133853 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT285996 NZ_LR027869:2133730-2133785 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|