Detailed information of TA system TA285994

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): sprA1-sprA1AS/-
• Location: 1919474..1919656
• Replicon: chromosome
• Accession: NZ_LR027869
• Organism: Staphylococcus aureus isolate BPH2869

Toxin (Protein)

• Gene name: sprA1
• Uniprot ID: -
• Locus tag: E0E09_RS09720
• Protein ID: WP_001801861.1
• Coordinates: 1919474..1919569 (+)
• Length: 32 a.a.

Antitoxin (RNA)

Gene name	sprA1AS
Locus tag	-
Coordinates	1919597..1919656 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E0E09_RS09670	1915134..1915760	+	627	WP_000669046.1	hypothetical protein	-
E0E09_RS09675	1915801..1916145	+	345	WP_000627551.1	DUF3969 family protein	-
E0E09_RS09680	1916243..1916794	+	552	WP_000414205.1	hypothetical protein	-
E0E09_RS09685	1917012..1917653	-	642	WP_000494956.1	ImmA/IrrE family metallo-endopeptidase	-
E0E09_RS09690	1917767..1917952	-	186	WP_000809857.1	hypothetical protein	-
E0E09_RS09695	1917954..1918130	-	177	WP_000375476.1	hypothetical protein	-
E0E09_RS09700	1918141..1918524	-	384	WP_000070811.1	hypothetical protein	-
E0E09_RS09710	1919128..1919271	-	144	WP_001549059.1	transposase	-
E0E09_RS09720	1919474..1919569	+	96	WP_001801861.1	type I toxin-antitoxin system Fst family toxin PepA1	Toxin
-	1919597..1919656	-	60	-	-	Antitoxin
E0E09_RS09725	1919692..1919793	+	102	WP_001791893.1	hypothetical protein	-
E0E09_RS09730	1919771..1919947	-	177	Protein_1825	transposase	-
E0E09_RS09735	1920141..1920518	-	378	WP_001037045.1	DUF1433 domain-containing protein	-
E0E09_RS09740	1921190..1922362	-	1173	WP_000195429.1	IS256-like element IS256 family transposase	-
E0E09_RS09745	1922466..1922996	+	531	Protein_1828	IS256-like element IS256 family transposase	-
E0E09_RS09750	1923032..1923694	-	663	Protein_1829	IS256 family transposase	-
E0E09_RS09755	1923801..1924367	+	567	WP_001092763.1	DUF4888 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 32 a.a.
• Molecular weight: 3554.32 Da
• Isoelectric Point: 10.4449

>T285994 WP_001801861.1 NZ_LR027869:1919474-1919569 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Nucleotide

• Length: 96 bp

Antitoxin

Nucleotide

• Length: 60 bp

>AT285994 NZ_LR027869:c1919656-1919597 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Structures

Antitoxin