Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1919474..1919656 | Replicon | chromosome |
| Accession | NZ_LR027869 | ||
| Organism | Staphylococcus aureus isolate BPH2869 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E0E09_RS09720 | Protein ID | WP_001801861.1 |
| Coordinates | 1919474..1919569 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1919597..1919656 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E09_RS09670 | 1915134..1915760 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| E0E09_RS09675 | 1915801..1916145 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| E0E09_RS09680 | 1916243..1916794 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| E0E09_RS09685 | 1917012..1917653 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E0E09_RS09690 | 1917767..1917952 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| E0E09_RS09695 | 1917954..1918130 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| E0E09_RS09700 | 1918141..1918524 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| E0E09_RS09710 | 1919128..1919271 | - | 144 | WP_001549059.1 | transposase | - |
| E0E09_RS09720 | 1919474..1919569 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1919597..1919656 | - | 60 | - | - | Antitoxin |
| E0E09_RS09725 | 1919692..1919793 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| E0E09_RS09730 | 1919771..1919947 | - | 177 | Protein_1825 | transposase | - |
| E0E09_RS09735 | 1920141..1920518 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| E0E09_RS09740 | 1921190..1922362 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| E0E09_RS09745 | 1922466..1922996 | + | 531 | Protein_1828 | IS256-like element IS256 family transposase | - |
| E0E09_RS09750 | 1923032..1923694 | - | 663 | Protein_1829 | IS256 family transposase | - |
| E0E09_RS09755 | 1923801..1924367 | + | 567 | WP_001092763.1 | DUF4888 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T285994 WP_001801861.1 NZ_LR027869:1919474-1919569 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT285994 NZ_LR027869:c1919656-1919597 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|