Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 5518157..5518761 | Replicon | chromosome |
Accession | NZ_LR027557 | ||
Organism | Pseudomonas synxantha strain 10586 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | KR485_RS24570 | Protein ID | WP_057022036.1 |
Coordinates | 5518447..5518761 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KR485_RS24565 | Protein ID | WP_003189536.1 |
Coordinates | 5518157..5518444 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KR485_RS24530 | 5513433..5514191 | + | 759 | WP_005786028.1 | MBL fold metallo-hydrolase | - |
KR485_RS24535 | 5514219..5514932 | + | 714 | WP_005786030.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
KR485_RS24545 | 5515201..5515494 | - | 294 | WP_057022032.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KR485_RS24550 | 5515484..5515723 | - | 240 | WP_014717442.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
KR485_RS24555 | 5516367..5516618 | + | 252 | WP_103733513.1 | DUF3077 domain-containing protein | - |
KR485_RS24560 | 5516692..5517918 | - | 1227 | WP_032877262.1 | MFS transporter | - |
KR485_RS24565 | 5518157..5518444 | - | 288 | WP_003189536.1 | NadS family protein | Antitoxin |
KR485_RS24570 | 5518447..5518761 | - | 315 | WP_057022036.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KR485_RS24575 | 5518867..5519808 | - | 942 | WP_216090883.1 | LysR family transcriptional regulator | - |
KR485_RS24580 | 5519966..5521282 | + | 1317 | WP_216090884.1 | MFS transporter | - |
KR485_RS24585 | 5521294..5522526 | + | 1233 | WP_216090885.1 | Zn-dependent hydrolase | - |
KR485_RS24590 | 5522661..5523698 | + | 1038 | WP_216090886.1 | histone deacetylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | mucA / mucD | 5505006..5518761 | 13755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11656.44 Da Isoelectric Point: 9.8054
>T285991 WP_057022036.1 NZ_LR027557:c5518761-5518447 [Pseudomonas synxantha]
MIFIETSVFTRRVKELIDEDAYTALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTADERKSLKAAIEHWR
MIFIETSVFTRRVKELIDEDAYTALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTADERKSLKAAIEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|