Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 1481174..1481828 | Replicon | chromosome |
Accession | NZ_LR027557 | ||
Organism | Pseudomonas synxantha strain 10586 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0D0TQT9 |
Locus tag | KR485_RS06295 | Protein ID | WP_043046578.1 |
Coordinates | 1481174..1481524 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0W0N117 |
Locus tag | KR485_RS06300 | Protein ID | WP_014718915.1 |
Coordinates | 1481514..1481828 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KR485_RS06285 | 1477933..1479465 | + | 1533 | WP_216091711.1 | NADH-quinone oxidoreductase subunit M | - |
KR485_RS06290 | 1479473..1480936 | + | 1464 | WP_216091712.1 | NADH-quinone oxidoreductase subunit NuoN | - |
KR485_RS06295 | 1481174..1481524 | + | 351 | WP_043046578.1 | toxin | Toxin |
KR485_RS06300 | 1481514..1481828 | + | 315 | WP_014718915.1 | XRE family transcriptional regulator | Antitoxin |
KR485_RS06305 | 1481887..1482639 | - | 753 | WP_032880612.1 | outer membrane beta-barrel protein | - |
KR485_RS06310 | 1482765..1483598 | - | 834 | WP_148853515.1 | arylamine N-acetyltransferase | - |
KR485_RS06315 | 1483719..1483955 | + | 237 | WP_005789137.1 | hypothetical protein | - |
KR485_RS06320 | 1483986..1484180 | - | 195 | WP_005789138.1 | DUF6021 family protein | - |
KR485_RS06325 | 1484193..1484372 | - | 180 | WP_005789140.1 | hypothetical protein | - |
KR485_RS06330 | 1484488..1485009 | + | 522 | WP_032880610.1 | DUF3087 family protein | - |
KR485_RS06335 | 1485039..1485899 | - | 861 | WP_032880609.1 | Dyp-type peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13785.70 Da Isoelectric Point: 9.7334
>T285985 WP_043046578.1 NZ_LR027557:1481174-1481524 [Pseudomonas synxantha]
MDALFIELPAFERHRKDYLSEELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLTPHHKKALKHMLDREIKARTHHET
MDALFIELPAFERHRKDYLSEELFQGFQQELMKNPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLTPHHKKALKHMLDREIKARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D0TQT9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W0N117 |