Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3553566..3554236 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | DKC2_RS17430 | Protein ID | WP_003899954.1 |
Coordinates | 3553566..3553910 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | DKC2_RS17435 | Protein ID | WP_003899955.1 |
Coordinates | 3553907..3554236 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS17395 | 3548639..3549499 | + | 861 | WP_003416628.1 | alpha/beta hydrolase | - |
DKC2_RS17400 | 3549474..3549989 | + | 516 | WP_003899950.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
DKC2_RS17410 | 3550229..3550522 | + | 294 | WP_003416635.1 | hypothetical protein | - |
DKC2_RS17415 | 3550810..3552099 | + | 1290 | WP_003416640.1 | ATP-binding protein | - |
DKC2_RS17420 | 3552446..3552880 | - | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS17425 | 3552883..3553335 | - | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DKC2_RS17430 | 3553566..3553910 | + | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DKC2_RS17435 | 3553907..3554236 | + | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
DKC2_RS17440 | 3554774..3555121 | + | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
DKC2_RS17445 | 3555118..3555738 | + | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
DKC2_RS17450 | 3555898..3557163 | - | 1266 | WP_003912135.1 | hypothetical protein | - |
DKC2_RS17455 | 3557331..3557540 | + | 210 | WP_003416778.1 | hypothetical protein | - |
DKC2_RS17465 | 3557787..3558821 | - | 1035 | WP_003416786.1 | IS30 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T285977 WP_003899954.1 NZ_LR027516:3553566-3553910 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6LTY | |
PDB | 6LTZ | |
AlphaFold DB | G0THF6 |