Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2277489..2278408 | Replicon | chromosome |
| Accession | NZ_LR027516 | ||
| Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | L7N4R2 |
| Locus tag | DKC2_RS11075 | Protein ID | WP_003900449.1 |
| Coordinates | 2277803..2278408 (-) | Length | 202 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | L7N5K9 |
| Locus tag | DKC2_RS11070 | Protein ID | WP_003410124.1 |
| Coordinates | 2277489..2277794 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKC2_RS11035 | 2272500..2273756 | - | 1257 | WP_003410095.1 | HNH endonuclease | - |
| DKC2_RS11045 | 2274110..2274685 | + | 576 | WP_003410100.1 | hypothetical protein | - |
| DKC2_RS11050 | 2274682..2275722 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DKC2_RS11055 | 2275964..2276683 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
| DKC2_RS11060 | 2276673..2277089 | + | 417 | WP_003410114.1 | hypothetical protein | - |
| DKC2_RS11065 | 2277105..2277404 | - | 300 | WP_003410120.1 | hypothetical protein | - |
| DKC2_RS11070 | 2277489..2277794 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
| DKC2_RS11075 | 2277803..2278408 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DKC2_RS11080 | 2278433..2278792 | - | 360 | WP_003410131.1 | hypothetical protein | - |
| DKC2_RS11085 | 2278952..2279410 | - | 459 | Protein_2095 | hypothetical protein | - |
| DKC2_RS11090 | 2279407..2280924 | - | 1518 | Protein_2096 | DEAD/DEAH box helicase | - |
| DKC2_RS11095 | 2281434..2282432 | - | 999 | WP_003410146.1 | cation diffusion facilitator family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T285959 WP_003900449.1 NZ_LR027516:c2278408-2277803 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BV20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7EWC | |
| PDB | 7EWD | |
| PDB | 7EWE | |
| AlphaFold DB | A0A7U4BV30 |