Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2212402..2213270 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | DKC2_RS10675 | Protein ID | WP_010886136.1 |
Coordinates | 2212402..2212779 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | DKC2_RS10680 | Protein ID | WP_003409886.1 |
Coordinates | 2212821..2213270 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS10625 | 2208191..2208643 | - | 453 | WP_003899095.1 | lipoprotein | - |
DKC2_RS10630 | 2208707..2209108 | + | 402 | WP_003409869.1 | hypothetical protein | - |
DKC2_RS10635 | 2209101..2209283 | - | 183 | WP_003409870.1 | hypothetical protein | - |
DKC2_RS10640 | 2209397..2209747 | - | 351 | WP_003899096.1 | hypothetical protein | - |
DKC2_RS10645 | 2209758..2210660 | - | 903 | WP_003899097.1 | hypothetical protein | - |
DKC2_RS10650 | 2210681..2210872 | - | 192 | WP_003409876.1 | hypothetical protein | - |
DKC2_RS10655 | 2210873..2211169 | - | 297 | WP_003409877.1 | hypothetical protein | - |
DKC2_RS10660 | 2211409..2211624 | + | 216 | WP_003409878.1 | antitoxin | - |
DKC2_RS10665 | 2211621..2211932 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS21630 | 2211906..2212427 | - | 522 | WP_003904745.1 | hypothetical protein | - |
DKC2_RS10675 | 2212402..2212779 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
DKC2_RS10680 | 2212821..2213270 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
DKC2_RS10685 | 2213267..2213812 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
DKC2_RS10690 | 2213701..2214315 | - | 615 | WP_003901296.1 | hypothetical protein | - |
DKC2_RS10695 | 2214364..2214660 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
DKC2_RS10700 | 2214657..2214908 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
DKC2_RS10705 | 2214895..2215389 | + | 495 | WP_003899099.1 | hypothetical protein | - |
DKC2_RS10710 | 2215549..2215956 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS10715 | 2215960..2216232 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DKC2_RS10720 | 2216265..2217485 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T285953 WP_010886136.1 NZ_LR027516:2212402-2212779 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT285953 WP_003409886.1 NZ_LR027516:2212821-2213270 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|