Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2358352..2358723 | Replicon | chromosome |
Accession | NZ_LR025101 | ||
Organism | Escherichia coli isolate EC-1639 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | EC1639_RS11395 | Protein ID | WP_001317028.1 |
Coordinates | 2358529..2358723 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2358352..2358530 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1639_RS11370 | 2354307..2355680 | + | 1374 | WP_000123754.1 | ATP-dependent RNA helicase DbpA | - |
EC1639_RS11375 | 2355809..2356744 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
EC1639_RS11380 | 2356796..2358031 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
EC1639_RS11385 | 2358033..2358248 | - | 216 | WP_000079604.1 | excisionase XisR | - |
EC1639_RS11390 | 2358327..2358536 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
- | 2358352..2358530 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 2358352..2358530 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 2358352..2358530 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 2358352..2358530 | + | 179 | NuclAT_0 | - | Antitoxin |
EC1639_RS11395 | 2358529..2358723 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
EC1639_RS11400 | 2358780..2359589 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
EC1639_RS11405 | 2359582..2362182 | - | 2601 | WP_001586992.1 | exodeoxyribonuclease VIII | - |
EC1639_RS11410 | 2362284..2362559 | - | 276 | WP_000632297.1 | protein RacC | - |
EC1639_RS11415 | 2362634..2362804 | - | 171 | WP_001352098.1 | conserved protein, Rac prophage | - |
EC1639_RS11420 | 2362804..2363025 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2356796..2404348 | 47552 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T285898 WP_001317028.1 NZ_LR025101:c2358723-2358529 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT285898 NZ_LR025101:2358352-2358530 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|