Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1095844..1096538 | Replicon | chromosome |
Accession | NZ_LR025101 | ||
Organism | Escherichia coli isolate EC-1639 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | V0YKG6 |
Locus tag | EC1639_RS05160 | Protein ID | WP_001263485.1 |
Coordinates | 1096140..1096538 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | EC1639_RS05155 | Protein ID | WP_000554758.1 |
Coordinates | 1095844..1096137 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1639_RS05135 | 1091261..1091758 | + | 498 | WP_000006263.1 | REP-associated tyrosine transposase RayT | - |
EC1639_RS05140 | 1092197..1093909 | - | 1713 | Protein_964 | flagellar biosynthesis protein FlhA | - |
EC1639_RS05145 | 1093881..1094666 | + | 786 | WP_000207554.1 | putative lateral flagellar export/assembly protein LafU | - |
EC1639_RS05150 | 1094737..1095792 | + | 1056 | WP_001226177.1 | DNA polymerase IV | - |
EC1639_RS05155 | 1095844..1096137 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
EC1639_RS05160 | 1096140..1096538 | + | 399 | WP_001263485.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
EC1639_RS05165 | 1096548..1097000 | + | 453 | WP_001059899.1 | GNAT family N-acetyltransferase | - |
EC1639_RS05170 | 1097246..1097452 | + | 207 | Protein_970 | RtcB family protein | - |
EC1639_RS26030 | 1097448..1097800 | + | 353 | Protein_971 | peptide chain release factor H | - |
EC1639_RS05180 | 1097857..1099314 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
EC1639_RS05185 | 1099575..1100033 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
EC1639_RS05190 | 1100125..1101369 | + | 1245 | WP_001586695.1 | esterase FrsA | - |
- | 1100629..1100709 | + | 81 | NuclAT_12 | - | - |
- | 1100629..1100709 | + | 81 | NuclAT_12 | - | - |
- | 1100629..1100709 | + | 81 | NuclAT_12 | - | - |
- | 1100629..1100709 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15418.84 Da Isoelectric Point: 7.3840
>T285889 WP_001263485.1 NZ_LR025101:1096140-1096538 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|