Detailed information of TA system TA285868

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 9533..9802
• Replicon: plasmid 2
• Accession: NZ_LR025097
• Organism: Escherichia coli isolate EC-7215

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: EC7215_RS23515
• Protein ID: WP_001312861.1
• Coordinates: 9644..9802 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	9533..9598 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EC7215_RS23490	5326..5853	+	528	WP_000290793.1	single-stranded DNA-binding protein	-
EC7215_RS23495	5909..6142	+	234	WP_000006004.1	DUF905 domain-containing protein	-
EC7215_RS23500	6201..8159	+	1959	WP_054444128.1	ParB/RepB/Spo0J family partition protein	-
EC7215_RS23505	8214..8648	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
EC7215_RS23510	8645..9364	+	720	WP_001276228.1	plasmid SOS inhibition protein A	-
EC7215_RS24885	9376..9564	-	189	WP_001299721.1	hypothetical protein	-
-	9376..9600	+	225	NuclAT_0	-	-
-	9376..9600	+	225	NuclAT_0	-	-
-	9376..9600	+	225	NuclAT_0	-	-
-	9376..9600	+	225	NuclAT_0	-	-
-	9533..9598	-	66	-	-	Antitoxin
EC7215_RS23515	9644..9802	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
EC7215_RS23530	10493..10699	+	207	WP_000547939.1	hypothetical protein	-
EC7215_RS23535	10724..11011	+	288	WP_000107535.1	hypothetical protein	-
EC7215_RS23540	11132..11953	+	822	WP_001234469.1	DUF945 domain-containing protein	-
EC7215_RS23545	12250..12852	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
EC7215_RS23550	13173..13556	+	384	WP_001151524.1	relaxosome protein TraM	-
EC7215_RS23555	13743..14432	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	dfrA14 / mph(A) / blaTEM-1B / aadA2 / sul3 / ant(3'')-Ia / aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / floR / tet(A) / sitABCD	iroN / iroE / iroD / iroC / iroB	1..142200	142200

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T285868 WP_001312861.1 NZ_LR025097:9644-9802 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT285868 NZ_LR025097:c9598-9533 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin