Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4224853..4225652 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | EC7215_RS20435 | Protein ID | WP_000347267.1 |
Coordinates | 4225188..4225652 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EC7215_RS20430 | Protein ID | WP_001307405.1 |
Coordinates | 4224853..4225188 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS20415 | 4220638..4221408 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
EC7215_RS20420 | 4221424..4222758 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
EC7215_RS20425 | 4223133..4224704 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
EC7215_RS20430 | 4224853..4225188 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EC7215_RS20435 | 4225188..4225652 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EC7215_RS20440 | 4225707..4226516 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EC7215_RS20445 | 4226765..4228045 | + | 1281 | WP_000681933.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EC7215_RS20450 | 4228068..4228541 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EC7215_RS20455 | 4228552..4229331 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EC7215_RS20460 | 4229321..4230199 | + | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EC7215_RS20465 | 4230217..4230651 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4214197..4225652 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T285864 WP_000347267.1 NZ_LR025096:4225188-4225652 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |