Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 206447..207049 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | EC7215_RS01000 | Protein ID | WP_000897305.1 |
Coordinates | 206447..206758 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | EC7215_RS01005 | Protein ID | WP_000356397.1 |
Coordinates | 206759..207049 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS00970 | 201477..202262 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
EC7215_RS00975 | 202361..202960 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
EC7215_RS00980 | 202954..203826 | + | 873 | WP_072643613.1 | virulence factor BrkB family protein | - |
EC7215_RS00985 | 203823..204260 | + | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
EC7215_RS00990 | 204305..205246 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
EC7215_RS00995 | 205310..206218 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
EC7215_RS01000 | 206447..206758 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
EC7215_RS01005 | 206759..207049 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
EC7215_RS01010 | 207654..207872 | + | 219 | WP_001297075.1 | ribbon-helix-helix domain-containing protein | - |
EC7215_RS01015 | 208091..208333 | + | 243 | WP_001086388.1 | hypothetical protein | - |
EC7215_RS01020 | 208663..209592 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
EC7215_RS01025 | 209589..210224 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
EC7215_RS01030 | 210221..211123 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T285848 WP_000897305.1 NZ_LR025096:206447-206758 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|