Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4421916..4422502 Replicon chromosome
Accession NZ_LR025092
Organism Klebsiella pneumoniae isolate KP9201

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag KP920_RS22280 Protein ID WP_023285605.1
Coordinates 4421916..4422284 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag KP920_RS22285 Protein ID WP_004174006.1
Coordinates 4422281..4422502 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP920_RS22260 4417419..4418489 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
KP920_RS22265 4418491..4419336 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KP920_RS22270 4419333..4420220 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KP920_RS22275 4420327..4421643 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KP920_RS22280 4421916..4422284 - 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KP920_RS22285 4422281..4422502 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KP920_RS22290 4422666..4423379 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KP920_RS22295 4423381..4424148 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KP920_RS22300 4424145..4425422 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
KP920_RS22305 4425419..4426345 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4416682..4425422 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T285842 WP_023285605.1 NZ_LR025092:c4422284-4421916 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT285842 WP_004174006.1 NZ_LR025092:c4422502-4422281 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References