Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4395673..4396313 | Replicon | chromosome |
Accession | NZ_LR025092 | ||
Organism | Klebsiella pneumoniae isolate KP9201 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | KP920_RS22170 | Protein ID | WP_016529833.1 |
Coordinates | 4395966..4396313 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KP920_RS22165 | Protein ID | WP_040181955.1 |
Coordinates | 4395673..4395966 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP920_RS22145 | 4391872..4392630 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
KP920_RS22150 | 4392680..4393510 | - | 831 | WP_024622927.1 | rhomboid family intramembrane serine protease GlpG | - |
KP920_RS22155 | 4393561..4393890 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
KP920_RS22160 | 4394095..4395603 | + | 1509 | WP_023301456.1 | glycerol-3-phosphate dehydrogenase | - |
KP920_RS22165 | 4395673..4395966 | - | 294 | WP_040181955.1 | helix-turn-helix transcriptional regulator | Antitoxin |
KP920_RS22170 | 4395966..4396313 | - | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KP920_RS22175 | 4396489..4398936 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
KP920_RS22180 | 4398954..4400387 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T285841 WP_016529833.1 NZ_LR025092:c4396313-4395966 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|