285823

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3397628..3398214 Replicon chromosome
Accession NZ_LR025088
Organism Klebsiella pneumoniae isolate KP980

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag KP980_RS17180 Protein ID WP_023285605.1
Coordinates 3397628..3397996 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag KP980_RS17185 Protein ID WP_004174006.1
Coordinates 3397993..3398214 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP980_RS17160 3393131..3394201 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
KP980_RS17165 3394203..3395048 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KP980_RS17170 3395045..3395932 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KP980_RS17175 3396039..3397355 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KP980_RS17180 3397628..3397996 - 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KP980_RS17185 3397993..3398214 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KP980_RS17190 3398378..3399091 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KP980_RS17195 3399093..3399860 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KP980_RS17200 3399857..3401134 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
KP980_RS17205 3401131..3402057 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3392394..3413108 20714


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T285823 WP_023285605.1 NZ_LR025088:c3397996-3397628 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT285823 WP_004174006.1 NZ_LR025088:c3398214-3397993 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References