Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3397628..3398214 | Replicon | chromosome |
| Accession | NZ_LR025088 | ||
| Organism | Klebsiella pneumoniae isolate KP980 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | KP980_RS17180 | Protein ID | WP_023285605.1 |
| Coordinates | 3397628..3397996 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | KP980_RS17185 | Protein ID | WP_004174006.1 |
| Coordinates | 3397993..3398214 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP980_RS17160 | 3393131..3394201 | - | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| KP980_RS17165 | 3394203..3395048 | - | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| KP980_RS17170 | 3395045..3395932 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| KP980_RS17175 | 3396039..3397355 | - | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| KP980_RS17180 | 3397628..3397996 | - | 369 | WP_023285605.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| KP980_RS17185 | 3397993..3398214 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KP980_RS17190 | 3398378..3399091 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| KP980_RS17195 | 3399093..3399860 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| KP980_RS17200 | 3399857..3401134 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| KP980_RS17205 | 3401131..3402057 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3392394..3413108 | 20714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13534.89 Da Isoelectric Point: 8.6410
>T285823 WP_023285605.1 NZ_LR025088:c3397996-3397628 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|